PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo0G0125200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Dof
Protein Properties Length: 212aa    MW: 23755.2 Da    PI: 9.3076
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo0G0125200genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof106.11.9e-33131179250
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvP 50 
                     +e  lkcprCdstntkfCy+nnysl qPr+fCk+CrryWt+GGalrnvP
  Spipo0G0125200 131 PEPGLKCPRCDSTNTKFCYFNNYSLLQPRHFCKTCRRYWTRGGALRNVP 179
                     56789******************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-30115179IPR003851Zinc finger, Dof-type
PfamPF027013.7E-29135185IPR003851Zinc finger, Dof-type
PROSITE profilePS5088425.434135189IPR003851Zinc finger, Dof-type
PROSITE patternPS013610137173IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
SIITSGRLGK AKDSCGPWLL LISGLFSKLC RRHGLGLASM TPYKCLRGDI EPHRPLPEKK  60
EEKDQTMVFP SVPAFLDPPN WNQQPNYQQE AGGEVHQQPP APPQRPDDNV PGTARTSSMA  120
DRARLAKLPQ PEPGLKCPRC DSTNTKFCYF NNYSLLQPRH FCKTCRRYWT RGGALRNVPE  180
EINTRILTEG MNYVAETAKK IEEHRITIGL G*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0995953e-45FP099595.1 Phyllostachys edulis cDNA clone: bphylf055n22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009384882.13e-56PREDICTED: dof zinc finger protein DOF5.1-like
SwissprotQ9M2U15e-40DOF36_ARATH; Dof zinc finger protein DOF3.6
TrEMBLM0RV224e-52M0RV22_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P24420_0011e-51(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.19e-37OBF-binding protein 3